PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA5943
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CO-like
Protein Properties Length: 398aa    MW: 45005 Da    PI: 6.6176
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA5943genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.44.6e-06434535
                  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHk 35
                               C+ ++  ++ l+C+ ++  lC  C ++ H+
  Tp57577_TGAC_v2_mRNA5943  4 PCDYCDTRNAVLYCKPDSAKLCLVCDQHVHS 34
                              6******99******************9995 PP

2CCT66.76.7e-23347390144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               R  a+lRYkeK+ktR+F+K+irYesRKa+A++R+Rv+GrFvk++
  Tp57577_TGAC_v2_mRNA5943 347 RGDAMLRYKEKKKTRRFDKHIRYESRKARADTRKRVRGRFVKAS 390
                               6789**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.328147IPR000315B-box-type zinc finger
CDDcd000216.69E-7335No hitNo description
SMARTSM003368.2E-7447IPR000315B-box-type zinc finger
CDDcd000210.005124778No hitNo description
PfamPF062031.3E-16347389IPR010402CCT domain
PROSITE profilePS5101715.12347389IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MSFPCDYCDT RNAVLYCKPD SAKLCLVCDQ HVHSANALAL KHVRYQICQN CKNDAASVRC  60
FTENLVQCHR CDWDAHGGGD SSSSSSSHHH HNLRRLDGLT GCPSVHEIVS ALGLDLKPND  120
AVFVAEFEGP VVPVVQNRDE VYEQVVEVAK RKRDLNWSVC GEVENEFRFN DCSNEVDDFL  180
LLQQTPFTSL LNFSSEFDVG AKKNHNNDYG NDAEVLLWNR NPTYQPPQVW DFQLQKSRDM  240
TFNGVEDASL SIPKSLQDVH NMNCSTLGDD VLSRNNQSDQ SSSSQVKKKV ESNKKTRDEL  300
SSESRLIESI TYSGADKVPV MDHLLSGSEY VSNINAQVGL EEQARNRGDA MLRYKEKKKT  360
RRFDKHIRYE SRKARADTRK RVRGRFVKAS DTSDNQE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003624458.10.0zinc finger constans-like protein
TrEMBLG7KW760.0G7KW76_MEDTR; Uncharacterized protein
STRINGGLYMA19G27240.11e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47372843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.16e-57B-box type zinc finger protein with CCT domain